"UBE2V2" Related Products

Expand

Recombinant Human UBE2V2, His-tagged

Cat.No.: UBE2V2-30036TH
Product Overview: Recombinant full length Human MMS2 with N terminal His tag; 165aa, 18.5kDa.
Description: Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.
Protein length: 145 amino acids
Conjugation: HIS
Molecular Weight: 18.500kDa inclusive of tags
Source: E. coli
Tissue specificity: Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.24% Tris, 10% Glycerol, 0.58% Sodium chloride
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELE EGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDA RSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG QTYNN
Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.
Gene Name: UBE2V2 ubiquitin-conjugating enzyme E2 variant 2 [ Homo sapiens ]
Official Symbol: UBE2V2
Synonyms: UBE2V2; ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; EDPF 1; MMS2; UEV 2;
Gene ID: 7336
mRNA Refseq: NM_003350
Protein Refseq: NP_003341
MIM: 603001
Uniprot ID: Q15819
Chromosome Location: 8q11.21
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: acid-amino acid ligase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.