Recombinant Human UBE2V2, His-tagged
Cat.No. : | UBE2V2-30036TH |
Product Overview : | Recombinant full length Human MMS2 with N terminal His tag; 165aa, 18.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 145 amino acids |
Description : | Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. |
Conjugation : | HIS |
Molecular Weight : | 18.500kDa inclusive of tags |
Tissue specificity : | Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELE EGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDA RSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG QTYNN |
Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
Gene Name | UBE2V2 ubiquitin-conjugating enzyme E2 variant 2 [ Homo sapiens ] |
Official Symbol | UBE2V2 |
Synonyms | UBE2V2; ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; EDPF 1; MMS2; UEV 2; |
Gene ID | 7336 |
mRNA Refseq | NM_003350 |
Protein Refseq | NP_003341 |
MIM | 603001 |
Uniprot ID | Q15819 |
Chromosome Location | 8q11.21 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | acid-amino acid ligase activity; protein binding; |
◆ Recombinant Proteins | ||
UBE2V2-3644H | Recombinant Human UBE2V2 protein, His-SUMO-tagged | +Inquiry |
UBE2V2-30036TH | Recombinant Human UBE2V2, His-tagged | +Inquiry |
UBE2V2-12674Z | Recombinant Zebrafish UBE2V2 | +Inquiry |
UBE2V2-5069R | Recombinant Rhesus monkey UBE2V2 Protein, His-tagged | +Inquiry |
UBE2V2-0522H | Recombinant Human UBE2V2 Protein (A2-N145), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2V2-559HCL | Recombinant Human UBE2V2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2V2 Products
Required fields are marked with *
My Review for All UBE2V2 Products
Required fields are marked with *