"UNC13D" Related Products

Recombinant Human UNC13D, His-tagged

Cat.No.: UNC13D-28544TH
Product Overview: Recombinant fragment, corresponding to amino acids 861-1090 of Human Munc 13-4 with a N terminal His tag; 34 kDa.
Description: This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.
Form: Lyophilised:Reconstitution with 146 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GCGLPPKALHTATFQALQRDLELQAASSRELIRKYFCSRI QQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLL PLDSNGSSDPFVQLTLEPRHEFPELAARETQKHKKDLH PLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEG EAFLPLREVPGLSGSEEPGEVPQTRLPLTYPAPNGDPI LQLLEGRKGDREAQVFVRLRRHRAKQASQHALRPAP
Sequence Similarities: Belongs to the unc-13 family.Contains 2 C2 domains.Contains 1 MHD1 (MUNC13 homology domain 1) domain.Contains 1 MHD2 (MUNC13 homology domain 2) domain.
Gene Name: UNC13D unc-13 homolog D (C. elegans) [ Homo sapiens ]
Official Symbol: UNC13D
Synonyms: UNC13D; unc-13 homolog D (C. elegans); protein unc-13 homolog D; Munc13 4;
Gene ID: 201294
mRNA Refseq: NM_199242
Protein Refseq: NP_954712
MIM: 608897
Uniprot ID: Q70J99
Chromosome Location: 17q25.3
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.