Recombinant Human UNC13D, His-tagged
Cat.No. : | UNC13D-28544TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 861-1090 of Human Munc 13-4 with a N terminal His tag; 34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 861-1090 a.a. |
Description : | This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder. |
Conjugation : | HIS |
Tissue specificity : | Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells. |
Form : | Lyophilised:Reconstitution with 146 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GCGLPPKALHTATFQALQRDLELQAASSRELIRKYFCSRI QQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLL PLDSNGSSDPFVQLTLEPRHEFPELAARETQKHKKDLH PLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEG EAFLPLREVPGLSGSEEPGEVPQTRLPLTYPAPNGDPI LQLLEGRKGDREAQVFVRLRRHRAKQASQHALRPAP |
Sequence Similarities : | Belongs to the unc-13 family.Contains 2 C2 domains.Contains 1 MHD1 (MUNC13 homology domain 1) domain.Contains 1 MHD2 (MUNC13 homology domain 2) domain. |
Gene Name | UNC13D unc-13 homolog D (C. elegans) [ Homo sapiens ] |
Official Symbol | UNC13D |
Synonyms | UNC13D; unc-13 homolog D (C. elegans); protein unc-13 homolog D; Munc13 4; |
Gene ID | 201294 |
mRNA Refseq | NM_199242 |
Protein Refseq | NP_954712 |
MIM | 608897 |
Uniprot ID | Q70J99 |
Chromosome Location | 17q25.3 |
Function | protein binding; |
◆ Recombinant Proteins | ||
UNC13D-6447R | Recombinant Rat UNC13D Protein | +Inquiry |
Unc13d-6836M | Recombinant Mouse Unc13d Protein, Myc/DDK-tagged | +Inquiry |
UNC13D-9912M | Recombinant Mouse UNC13D Protein, His (Fc)-Avi-tagged | +Inquiry |
UNC13D-17843M | Recombinant Mouse UNC13D Protein | +Inquiry |
UNC13D-28544TH | Recombinant Human UNC13D, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UNC13D-501HCL | Recombinant Human UNC13D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC13D Products
Required fields are marked with *
My Review for All UNC13D Products
Required fields are marked with *
0
Inquiry Basket