Recombinant Human UNC13D, His-tagged

Cat.No. : UNC13D-28544TH
Product Overview : Recombinant fragment, corresponding to amino acids 861-1090 of Human Munc 13-4 with a N terminal His tag; 34 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 861-1090 a.a.
Description : This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.
Conjugation : HIS
Tissue specificity : Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.
Form : Lyophilised:Reconstitution with 146 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GCGLPPKALHTATFQALQRDLELQAASSRELIRKYFCSRI QQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLL PLDSNGSSDPFVQLTLEPRHEFPELAARETQKHKKDLH PLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEG EAFLPLREVPGLSGSEEPGEVPQTRLPLTYPAPNGDPI LQLLEGRKGDREAQVFVRLRRHRAKQASQHALRPAP
Sequence Similarities : Belongs to the unc-13 family.Contains 2 C2 domains.Contains 1 MHD1 (MUNC13 homology domain 1) domain.Contains 1 MHD2 (MUNC13 homology domain 2) domain.
Gene Name UNC13D unc-13 homolog D (C. elegans) [ Homo sapiens ]
Official Symbol UNC13D
Synonyms UNC13D; unc-13 homolog D (C. elegans); protein unc-13 homolog D; Munc13 4;
Gene ID 201294
mRNA Refseq NM_199242
Protein Refseq NP_954712
MIM 608897
Uniprot ID Q70J99
Chromosome Location 17q25.3
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UNC13D Products

Required fields are marked with *

My Review for All UNC13D Products

Required fields are marked with *

0
cart-icon