Recombinant Human USP19, His-tagged USP19-29612TH

Recombinant Human USP19, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human USP19, His-tagged

Recombinant Human USP19, His-tagged

USP19 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : USP19-29612TH
Product Overview : Recombinant fragment, corresponding to amino acids 904-1318 of Human USP19 with N terminal His tag; 415 amino acids, 50kDa.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ERDPIQPPELQLVTPMAEGDTGLPRVWAAPDRGPVPSTSG ISSEMLASGPIEVGSLPAGERVSRPEAAVPGYQHPSEA MNAHTPQFFIYKIDSSNREQRLEDKGDTPLELGDDCSLAL VWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFT LDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLW RLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKF CIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPND RSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRR RNSPVERPPRAGHSEHHPDLGPAAEAAASQASRIWQELEA EEEPVPEGSGPLGPWGPQDWVGPLPRGPTTPDEGCLRY FVLGTVAALVALVLNVFYPLVSQSRWR
Sequence Similarities : Belongs to the peptidase C19 family.Contains 2 CS domains.Contains 1 MYND-type zinc finger.
Gene Name : USP19 ubiquitin specific peptidase 19 [ Homo sapiens ]
Official Symbol : USP19
Synonyms : USP19; ubiquitin specific peptidase 19; ubiquitin specific protease 19; ubiquitin carboxyl-terminal hydrolase 19; KIAA0891; ZMYND9;
Gene ID : 10869
mRNA Refseq : NM_001199161
Protein Refseq : NP_001186090
Uniprot ID : O94966
Chromosome Location : 3p21.31
Function : cysteine-type peptidase activity; metal ion binding; peptidase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy