Recombinant Human USP48, His-tagged
Cat.No. : | USP48-29615TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 789-1035 of Human USP48 with N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 137 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN PSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYV HKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKD PDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVR GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKIL SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV CMPEEGFKGTGLLGH |
Sequence Similarities : | Belongs to the peptidase C19 family.Contains 3 DUSP domains.Contains 1 ubiquitin-like domain. |
Gene Name : | USP48 ubiquitin specific peptidase 48 [ Homo sapiens ] |
Official Symbol : | USP48 |
Synonyms : | USP48; ubiquitin specific peptidase 48; ubiquitin specific protease 31 , ubiquitin specific protease 48 , USP31; ubiquitin carboxyl-terminal hydrolase 48; FLJ11328; FLJ20103; FLJ23054; FLJ23277; MGC14879; |
Gene ID : | 84196 |
mRNA Refseq : | NM_001032730 |
Protein Refseq : | NP_001027902 |
Uniprot ID : | Q86UV5 |
Chromosome Location : | 1p36.12 |
Function : | cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity; |
Products Types
◆ Recombinant Protein | ||
USP48-1004H | Recombinant Human USP48 Protein (A2-H1035), Flag tagged | +Inquiry |
USP48-103H | Recombinant Human USP48 Protein, GST-tagged | +Inquiry |
USP48-1003H | Recombinant Human USP48 Protein (A2-H1035), His/Flag tagged | +Inquiry |
USP48-6135R | Recombinant Rat USP48 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP48-3576C | Recombinant Chicken USP48 | +Inquiry |
◆ Lysates | ||
USP48-1896HCL | Recombinant Human USP48 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket