Recombinant Human USP48, His-tagged USP48-29615TH

Recombinant Human USP48, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human USP48, His-tagged

Recombinant Human USP48, His-tagged

USP48 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : USP48-29615TH
Product Overview : Recombinant fragment, corresponding to amino acids 789-1035 of Human USP48 with N terminal His tag; Predicted MWt 29 kDa.
Description : This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 137 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN PSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYV HKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKD PDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVR GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKIL SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV CMPEEGFKGTGLLGH
Sequence Similarities : Belongs to the peptidase C19 family.Contains 3 DUSP domains.Contains 1 ubiquitin-like domain.
Gene Name : USP48 ubiquitin specific peptidase 48 [ Homo sapiens ]
Official Symbol : USP48
Synonyms : USP48; ubiquitin specific peptidase 48; ubiquitin specific protease 31 , ubiquitin specific protease 48 , USP31; ubiquitin carboxyl-terminal hydrolase 48; FLJ11328; FLJ20103; FLJ23054; FLJ23277; MGC14879;
Gene ID : 84196
mRNA Refseq : NM_001032730
Protein Refseq : NP_001027902
Uniprot ID : Q86UV5
Chromosome Location : 1p36.12
Function : cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy