"USP48" Related Products

Recombinant Human USP48, His-tagged

Cat.No.: USP48-29615TH
Product Overview: Recombinant fragment, corresponding to amino acids 789-1035 of Human USP48 with N terminal His tag; Predicted MWt 29 kDa.
Description: This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 137 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN PSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYV HKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKD PDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVR GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKIL SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV CMPEEGFKGTGLLGH
Sequence Similarities: Belongs to the peptidase C19 family.Contains 3 DUSP domains.Contains 1 ubiquitin-like domain.
Gene Name: USP48 ubiquitin specific peptidase 48 [ Homo sapiens ]
Official Symbol: USP48
Synonyms: USP48; ubiquitin specific peptidase 48; ubiquitin specific protease 31 , ubiquitin specific protease 48 , USP31; ubiquitin carboxyl-terminal hydrolase 48; FLJ11328; FLJ20103; FLJ23054; FLJ23277; MGC14879;
Gene ID: 84196
mRNA Refseq: NM_001032730
Protein Refseq: NP_001027902
Uniprot ID: Q86UV5
Chromosome Location: 1p36.12
Function: cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.