Recombinant Human USP48, His-tagged

Cat.No. : USP48-29615TH
Product Overview : Recombinant fragment, corresponding to amino acids 789-1035 of Human USP48 with N terminal His tag; Predicted MWt 29 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 789-1035 a.a.
Description : This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation : HIS
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 137 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN PSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYV HKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKD PDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVR GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKIL SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV CMPEEGFKGTGLLGH
Sequence Similarities : Belongs to the peptidase C19 family.Contains 3 DUSP domains.Contains 1 ubiquitin-like domain.
Gene Name USP48 ubiquitin specific peptidase 48 [ Homo sapiens ]
Official Symbol USP48
Synonyms USP48; ubiquitin specific peptidase 48; ubiquitin specific protease 31 , ubiquitin specific protease 48 , USP31; ubiquitin carboxyl-terminal hydrolase 48; FLJ11328; FLJ20103; FLJ23054; FLJ23277; MGC14879;
Gene ID 84196
mRNA Refseq NM_001032730
Protein Refseq NP_001027902
Uniprot ID Q86UV5
Chromosome Location 1p36.12
Function cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All USP48 Products

Required fields are marked with *

My Review for All USP48 Products

Required fields are marked with *

0
cart-icon