Recombinant Human USP48, His-tagged

• Cat.No.: USP48-29615TH
• Product Overview: Recombinant fragment, corresponding to amino acids 789-1035 of Human USP48 with N terminal His tag; Predicted MWt 29 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 789-1035 a.a.
• Description: This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Conjugation: HIS
• Tissue specificity: Widely expressed.
• Form: Lyophilised:Reconstitute with 137 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN PSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYV HKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKD PDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVR GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKIL SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV CMPEEGFKGTGLLGH
• Sequence Similarities: Belongs to the peptidase C19 family.Contains 3 DUSP domains.Contains 1 ubiquitin-like domain.

Gene Information

• Gene Name: USP48 ubiquitin specific peptidase 48 [ Homo sapiens ]
• Official Symbol: USP48
• Synonyms: USP48; ubiquitin specific peptidase 48; ubiquitin specific protease 31 , ubiquitin specific protease 48 , USP31; ubiquitin carboxyl-terminal hydrolase 48; FLJ11328; FLJ20103; FLJ23054; FLJ23277; MGC14879
• Gene ID: 84196
• mRNA Refseq: NM_001032730
• Protein Refseq: NP_001027902
• Uniprot ID: Q86UV5
• Chromosome Location: 1p36.12
• Function: cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity