Recombinant Human USP48, His-tagged
| Cat.No. : | USP48-29615TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 789-1035 of Human USP48 with N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 789-1035 a.a. |
| Description : | This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Conjugation : | HIS |
| Tissue specificity : | Widely expressed. |
| Form : | Lyophilised:Reconstitute with 137 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN PSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYV HKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKD PDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVR GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKIL SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV CMPEEGFKGTGLLGH |
| Sequence Similarities : | Belongs to the peptidase C19 family.Contains 3 DUSP domains.Contains 1 ubiquitin-like domain. |
| Gene Name | USP48 ubiquitin specific peptidase 48 [ Homo sapiens ] |
| Official Symbol | USP48 |
| Synonyms | USP48; ubiquitin specific peptidase 48; ubiquitin specific protease 31 , ubiquitin specific protease 48 , USP31; ubiquitin carboxyl-terminal hydrolase 48; FLJ11328; FLJ20103; FLJ23054; FLJ23277; MGC14879; |
| Gene ID | 84196 |
| mRNA Refseq | NM_001032730 |
| Protein Refseq | NP_001027902 |
| Uniprot ID | Q86UV5 |
| Chromosome Location | 1p36.12 |
| Function | cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity; |
| ◆ Recombinant Proteins | ||
| USP48-1004H | Recombinant Human USP48 Protein (A2-H1035), Flag tagged | +Inquiry |
| USP48-6135R | Recombinant Rat USP48 Protein, His (Fc)-Avi-tagged | +Inquiry |
| USP48-29615TH | Recombinant Human USP48, His-tagged | +Inquiry |
| USP48-103H | Recombinant Human USP48 Protein, GST-tagged | +Inquiry |
| USP48-1003H | Recombinant Human USP48 Protein (A2-H1035), His/Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP48-1896HCL | Recombinant Human USP48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP48 Products
Required fields are marked with *
My Review for All USP48 Products
Required fields are marked with *
