"VAMP3" Related Products

Expand
Expand
Expand

Recombinant Human VAMP3

Cat.No.: VAMP3-27011TH
Product Overview: Recombinant fragment of Human Cellubrevin , 8.7 kDa.
Description: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Because of its high homology to other known VAMPs, its broad tissue distribution, and its subcellular localization, the protein encoded by this gene was shown to be the human equivalent of the rodent cellubrevin. In platelets the protein resides on a compartment that is not mobilized to the plasma membrane on calcium or thrombin stimulation.
Protein length: 77 amino acids
Molecular Weight: 8.700kDa
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 7.50Constituents:0.24% Tris, 10% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK
Sequence Similarities: Belongs to the synaptobrevin family.Contains 1 v-SNARE coiled-coil homology domain.
Gene Name: VAMP3 vesicle-associated membrane protein 3 (cellubrevin) [ Homo sapiens ]
Official Symbol: VAMP3
Synonyms: VAMP3; vesicle-associated membrane protein 3 (cellubrevin); vesicle-associated membrane protein 3; CEB;
Gene ID: 9341
mRNA Refseq: NM_004781
Protein Refseq: NP_004772
MIM: 603657
Uniprot ID: Q15836
Chromosome Location: 1p36.23
Pathway: Arf6 trafficking events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem;
Function: SNARE binding; protein binding; syntaxin-1 binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.