"VIP" Related Products

Expand
Expand

Recombinant Human VIP

Cat.No.: VIP-30160TH
Product Overview: Recombinant full length Human VIP isoform 2 with a proprietary tag: predicted molecular weight 44.66 kDa.
Description: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Protein length: 169 amino acids
Molecular Weight: 44.660kDa inclusive of tags
Source: Wheat germ
Biological activity: useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Sequence Similarities: Belongs to the glucagon family.
Gene Name: VIP vasoactive intestinal peptide [ Homo sapiens ]
Official Symbol: VIP
Synonyms: VIP; vasoactive intestinal peptide; VIP peptides;
Gene ID: 7432
mRNA Refseq: NM_003381
Protein Refseq: NP_003372
MIM: 192320
Uniprot ID: P01282
Chromosome Location: 6q24-q27
Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Glucagon-type ligand receptors, organism-specific biosystem;
Function: neuropeptide hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.