"YBX1" Related Products

Expand
Expand
Expand

Recombinant Human YBX1, His-tagged

Cat.No.: YBX1-30136TH
Product Overview: Recombinant fragment, corresponding to amino acids 4-364 of Human YB1 with N terminal His tag; 361 amino acids, 64kDa AAA35750.1.
Description: Y box binding protein 1, officially known as YBX1, but commonly referred to as "YB-1" by researchers, is a human protein. Current research is examining its involvement in cancer, and particularly in the metastasis of cancerous cells or prevention thereof.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 50μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: GPQRALSSPTAAAGLVTITPREEPQLPQPAPVTITATMSS EAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGG LTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRND TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRN YQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPP YYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPV RQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQG QQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAE NSSAPEAEQGGAE
Sequence Similarities: Contains 1 CSD (cold-shock) domain.
Gene Name: YBX1 Y box binding protein 1 [ Homo sapiens ]
Official Symbol: YBX1
Synonyms: YBX1; Y box binding protein 1; NSEP1, nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; BP 8; CSDA2; CSDB; DBPB; MDR NF1; NSEP 1; YB 1; YB1;
Gene ID: 4904
mRNA Refseq: NM_004559
Protein Refseq: NP_004550
MIM: 154030
Uniprot ID: P67809
Chromosome Location: 1p34
Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; IL-2 Signaling Pathway, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem;
Function: DNA binding; DNA binding; RNA binding; RNA binding; double-stranded DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.