Recombinant Human YWHAG, His-tagged
Cat.No. : | YWHAG-26009TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1-247 of Human 14-3-3 gamma, with an N-terminal His tag; predicted MWt 31.8 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo |
- Specification
- Gene Information
- Related Products
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. |
Protein length : | 247 amino acids |
Conjugation : | HIS |
Molecular Weight : | 31.800kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Highly expressed in brain, skeletal muscle, and heart. |
Form : | Liquid |
Purity : | Purified via His tag |
Storage buffer : | pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVDREQ LVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLS VAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYR EKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKM KGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ PTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGN N |
Sequence Similarities : | Belongs to the 14-3-3 family. |
Gene Name : | YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide [ Homo sapiens ] |
Official Symbol : | YWHAG |
Synonyms : | YWHAG; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 14-3-3 protein gamma; 14 3 3 gamma; |
Gene ID : | 7532 |
mRNA Refseq : | NM_012479 |
Protein Refseq : | NP_036611 |
MIM : | 605356 |
Uniprot ID : | P61981 |
Chromosome Location : | 7q11.23 |
Pathway : | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; |
Function : | insulin-like growth factor receptor binding; protein binding; protein domain specific binding; protein kinase C binding; protein kinase C inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
YWHAG-6295R | Recombinant Rat YWHAG Protein, His (Fc)-Avi-tagged | +Inquiry |
Ywhag-7041M | Recombinant Mouse Ywhag Protein, Myc/DDK-tagged | +Inquiry |
YWHAG-5060R | Recombinant Rhesus Macaque YWHAG Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAG-071H | Recombinant Human YWHAG Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
YWHAG-2379H | Recombinant Human YWHAG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
YWHAG-232HCL | Recombinant Human YWHAG 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket