Recombinant Human YWHAQ, His-tagged

Cat.No. : YWHAQ-26016TH
Product Overview : Recombinant full length protein corresponding to amino acids 1-245 of Human 14-3-3 Tau, with an N-terminal His(6) tag. Residue M35 of the fusion protein is equivalent to M1 of the native protein.The His(6) tag is located at residues 5 - 10.Protease cleava
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 245 amino acids
Description : This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Conjugation : HIS
Molecular Weight : 31.000kDa inclusive of tags
Tissue specificity : Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
Form : Liquid
Purity : Purified via His tag
Storage buffer : pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.004% PMSF, 0.012% Benzamidine
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTEL IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSV AYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKV ESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYF RYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTL NEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Sequence Similarities : Belongs to the 14-3-3 family.
Gene Name YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide [ Homo sapiens ]
Official Symbol YWHAQ
Synonyms YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau;
Gene ID 10971
mRNA Refseq NM_006826
Protein Refseq NP_006817
MIM 609009
Uniprot ID P27348
Chromosome Location 2p25.2-p25.1
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem;
Function protein N-terminus binding; protein binding; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YWHAQ Products

Required fields are marked with *

My Review for All YWHAQ Products

Required fields are marked with *

0
cart-icon
0
compare icon