"YWHAQ" Related Products

Expand

Recombinant Human YWHAQ, His-tagged

Cat.No.: YWHAQ-26016TH
Product Overview: Recombinant full length protein corresponding to amino acids 1-245 of Human 14-3-3 Tau, with an N-terminal His(6) tag. Residue M35 of the fusion protein is equivalent to M1 of the native protein.The His(6) tag is located at residues 5 - 10.Protease cleava
Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Protein length: 245 amino acids
Conjugation: HIS
Molecular Weight: 31.000kDa inclusive of tags
Source: E. coli
Tissue specificity: Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
Form: Liquid
Purity: Purified via His tag
Storage buffer: pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.004% PMSF, 0.012% Benzamidine
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTEL IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSV AYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKV ESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYF RYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTL NEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Sequence Similarities: Belongs to the 14-3-3 family.
Gene Name: YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide [ Homo sapiens ]
Official Symbol: YWHAQ
Synonyms: YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau;
Gene ID: 10971
mRNA Refseq: NM_006826
Protein Refseq: NP_006817
MIM: 609009
Uniprot ID: P27348
Chromosome Location: 2p25.2-p25.1
Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem;
Function: protein N-terminus binding; protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.