Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human YWHAQ, His-tagged

Cat.No. : YWHAQ-26016TH
Product Overview : Recombinant full length protein corresponding to amino acids 1-245 of Human 14-3-3 Tau, with an N-terminal His(6) tag. Residue M35 of the fusion protein is equivalent to M1 of the native protein.The His(6) tag is located at residues 5 - 10.Protease cleava
  • Specification
  • Gene Information
  • Related Products
Description : This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Protein length : 245 amino acids
Conjugation : HIS
Molecular Weight : 31.000kDa inclusive of tags
Source : E. coli
Tissue specificity : Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
Form : Liquid
Purity : Purified via His tag
Storage buffer : pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.004% PMSF, 0.012% Benzamidine
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTEL IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSV AYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKV ESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYF RYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTL NEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Sequence Similarities : Belongs to the 14-3-3 family.
Gene Name : YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide [ Homo sapiens ]
Official Symbol : YWHAQ
Synonyms : YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau;
Gene ID : 10971
mRNA Refseq : NM_006826
Protein Refseq : NP_006817
MIM : 609009
Uniprot ID : P27348
Chromosome Location : 2p25.2-p25.1
Pathway : Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem;
Function : protein N-terminus binding; protein binding; protein domain specific binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends