"ZCCHC17" Related Products

Expand

Recombinant Human ZCCHC17, His-tagged

Cat.No.: ZCCHC17-31652TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-241 of Human ZCCHC17 with N terminal His tag; MWt 34kDa.
Description: ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 123 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRK QGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKN DRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQ DYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTK YSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKK KKHKKKHKE
Sequence Similarities: Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain.
Gene Name: ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ]
Official Symbol: ZCCHC17
Synonyms: ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D;
Gene ID: 51538
mRNA Refseq: NM_016505
Protein Refseq: NP_057589
Uniprot ID: Q9NP64
Chromosome Location: 1p35.2
Function: RNA binding; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.