"ZNF238" Related Products

Recombinant Human ZNF238, His-tagged

Cat.No.: ZNF238-30757TH
Product Overview: Recombinant fragment, corresponding to amino acids 65-360 of Human ZNF238 with N terminal His tag; Predicted MWt 33 kDa.
Description: C2H2-type zinc finger proteins, such as ZNF238, act on the molecular level as transcriptional activators or repressors and are involved in chromatin assembly (Becker et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Lymphoid tissues, testis, heart, brain, skeletal muscle, and pancreas and, at much lower level, other tissues.
Form: Lyophilised:Reconstitute with 101 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYL HMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVE SLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEP GNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSS TESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHST VKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASD DEMMTPESERVQVEGGMESSLLPYVS
Sequence Similarities: Contains 1 BTB (POZ) domain.Contains 4 C2H2-type zinc fingers.
Gene Name: ZNF238 zinc finger protein 238 [ Homo sapiens ]
Official Symbol: ZNF238
Synonyms: ZNF238; zinc finger protein 238; C2H2 171; RP58; TAZ 1; ZBTB18;
Gene ID: 10472
mRNA Refseq: NM_006352
Protein Refseq: NP_006343
MIM: 608433
Uniprot ID: Q99592
Chromosome Location: 1q44-ter
Function: DNA binding; metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.