"ZNF444" Related Products

Recombinant Human ZNF444, His-tagged

Cat.No.: ZNF444-31569TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-327 of Human ZNF444 with an N terminal His tag. Predicted mwt: 36 kDa;
Description: ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEVAVPVKQEAEGLALDSPWHRFRRFHLGDAPGPREALGL LRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQA WVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQD VTQGPGATGGKEDSGMIPLAGTAPGAEGPAPGDSQAVRPY KQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHL LRHRQSHSGEKPHACPECGKAFRRKEHLRRHRDTHPGS PGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIHGRAAASAQGA VAPGPDGGGPFPPWPLG
Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 4 C2H2-type zinc fingers.Contains 1 SCAN box domain.
Gene Name: ZNF444 zinc finger protein 444 [ Homo sapiens ]
Official Symbol: ZNF444
Synonyms: ZNF444; zinc finger protein 444; EZF2; FLJ11137; ZSCAN17;
Gene ID: 55311
mRNA Refseq: NM_018337
Protein Refseq: NP_060807
MIM: 607874
Uniprot ID: Q8N0Y2
Chromosome Location: 19q13.43
Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.