"ZNF638" Related Products

Recombinant Human ZNF638, His-tagged

Cat.No.: ZNF638-31744TH
Product Overview: Recombinant fragment, corresponding to amino acids 1736-1978 of Human ZNF638 with N terminal His tag; Predicted MWt 28 kDa.
Description: The protein encoded by this gene is a nucleoplasmic protein. It binds cytidine-rich sequences in double-stranded DNA. This protein has three types of domains: MH1, MH2 (repeated three times) and MH3. It is associated with packaging, transferring, or processing transcripts. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 61 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VDEIQDDSSDLHLVTLDEVTEEDEDSLADFNNLKEELNFV TVDEVGEEEDGDNDLKVELAQSKNDHPTDKKGNRKKRA VDTKKTKLESLSQVGPVNENVMEEDLKTMIERHLTAKT PTKRVRIGKTLPSEKAVVTEPAKGEEAFQMSEVDEESG LKDSEPERKRKKTEDSSSGKSVASDVPEELDFLVPKAGFF CPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEK EQNEAEERSSR
Gene Name: ZNF638 zinc finger protein 638 [ Homo sapiens ]
Official Symbol: ZNF638
Synonyms: ZNF638; zinc finger protein 638; ZFML, zinc finger, matrin like; MGC26130; NP220; Zfp638;
Gene ID: 27332
mRNA Refseq: NM_014497
Protein Refseq: NP_055312
Uniprot ID: Q14966
Chromosome Location: 2p13.1
Function: DNA binding; RNA binding; double-stranded DNA binding; metal ion binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.