"GLRX2" Related Products

Expand
Expand

Recombinant Human Glutaredoxin 2, His-tagged

Cat. No.: GLRX2-1828H
Product Overview: Recombinant human Glutaredoxin 2, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography.
Description: Glutaredoxin-2, as known as GRX2, multifunctional enzyme with glutathione-dependent oxidoreductase, glutathione peroxidase and glutathione S-transferase(GST) activity. This protein is localized both in the mitochondria and nucleus. It has anti-apoptotic activity by preventing cardiolipin oxidation and cytochrome c release. GRX2 exhibited 36% identity with GRX1 and had a disulfide active center containing the Cys-Ser-Tyr-Cys motif.
Sequences of amino acids: MSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNC VVIFSK TSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTF I GGATDTH RLHKEGKLLP LVHQCYLKKS KRKEFQLEHH HHHH
Form: Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 0.1 mM PMSF, 10% Glycerol
Molecular Weight: 17.0 kDa (154aa)
Purity: > 90% by SDS - PAGE
Concentration: 0.5 mg/ml (determined by Bradford assay)
Storage: Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: GLRX2 glutaredoxin 2 [ Homo sapiens ]
Synonyms: GLRX2; GRX2; bA101E13.1; bA101E13.1; glutaredoxin 2; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); OTTHUMP00000033766; OTTHUMP00000033767; bA101E13.1; glutaredoxin 2.
Gene ID: 51022
mRNA Refseq: NM_016066
Protein Refseq: NP_057150
MIM: 606820
UniProt ID: Q9NS18
Chromosome Location: 1q31.2-q31.3
Function: 2 iron, 2 sulfur cluster binding; arsenate reductase (glutaredoxin) activity; electron carrier activity; glutathione disulfide oxidoreductase activity; iron ion binding; metal ion binding; protein disulfide oxidoreductase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.