"ANXA4" Related Products

Expand
Expand
Expand

Recombinant Human Annexin A4

Cat. No.: ANXA4-1842
Product Overview: Recombinant ANXA4 protein was expressed inE.coliand purified by using conventional chromatography techniques. MW = 36 kDa (321aa).
Description: ANXA4 belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. Isolated from human placenta, this protein has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.
Source: E.coli.
Form: Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.2M NaCl.
Purity: > 90% by SDS – PAGE.
Concentration: 1 mg/ml (determined by Bradford assay).
Sequences Of Amino Acids: MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQ RQEIR TAYKSTIGRDLIDDLKSELSGNFEQ VIVGMMTPTVLYDVQELRRA MKGAGTDEGC LIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAG GRDEGN Y LDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQK DIE QSIKSETSGSFEDALLA IVKCMRNKSA YFAEKLYKSM KGLGTDDNTLIRVMVSRAEI DMLDIRAHFK RLYGKSLYSF IKGDTSGDYR KVLLVLCGGD D.
Storage: can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: ANXA4 annexin A4 [ Homo sapiens ]
Synonyms: annexin A4; ANX4; PIG28; ZAP36; MGC75105; DKFZp686H02120; ANXA4; P32.5; PP4-X; PAP-II; annexin-4; protein II endonexin I; lipocortin IV; chromobindin-4; 35-beta calcimedin; proliferation-inducing gene 28; proliferation-inducing protein 28; placental anticoagulant protein II; carbohydrate-binding protein p33/p41;annexin IV (placental anticoagulant protein II); Placental anticoagulant protein II; Annexin IV; Chromobindin-4; Protein II; Endonexin I; Carbohydrate-binding protein p33/p41; Lipocortin IV; Annexin-4
Gene ID: 307
mRNA Refseq: NM_001153
Protein Refseq: NP_001144
MIM: 106491
UniProt ID: P09525
Chromosome Location: 2p13
Function: calcium ion binding; calcium-dependent phospholipid binding; phospholipase inhibitor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.