GMP Recombinant Mouse Mif Protein, His-Tagged

• Cat.No.: Mif-01M
• Product Overview: GMP Recombinant Mouse Mif Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Enables cytokine activity; phenylpyruvate tautomerase activity; and protease binding activity. Involved in several processes, including negative regulation of apoptotic process; positive regulation of macromolecule metabolic process; and regulation of signal transduction. Acts upstream of or within DNA damage response, signal transduction by p53 class mediator; cell aging; and regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Human ortholog(s) of this gene implicated in allergic disease; asthma; cystic fibrosis; lung disease (multiple); and obesity. Orthologous to human MIF (macrophage migration inhibitory factor).
• Form: Lyophilized
• AA Sequence: MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Mif macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Mus musculus (house mouse) ]
• Official Symbol: Mif
• Synonyms: GIF; DER6; Glif
• Gene ID: 17319
• mRNA Refseq: NM_010798.3
• Protein Refseq: NP_034928.1
• UniProt ID: P34884