Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
Enables cytokine activity; phenylpyruvate tautomerase activity; and protease binding activity. Involved in several processes, including negative regulation of apoptotic process; positive regulation of macromolecule metabolic process; and regulation of signal transduction. Acts upstream of or within DNA damage response, signal transduction by p53 class mediator; cell aging; and regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Human ortholog(s) of this gene implicated in allergic disease; asthma; cystic fibrosis; lung disease (multiple); and obesity. Orthologous to human MIF (macrophage migration inhibitory factor). |
Form : |
Lyophilized |
AA Sequence : |
MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA with polyhistidine tag at the C-terminus |
Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
Purity : |
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
Notes : |
Please use within one month after protein reconstitution. |
Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |