Mouse Anti-PTRF Monoclonal Antibody

• Cat.No.: DMABT-H14716
• Product Overview: Mouse Anti-PTRF Monoclonal Antibody

Specification

• Species: Human
• Source: Mouse
• Tag: Non
• Target: PTRF
• Immunogen: PTRF (NP_036364, 233 a.a. ~432a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Isotype: IgG2b Kappa
• species: Human
• Clone: 2G8
• Conjugation: N/A
• Applications: WB,IHC,ICC,IP
• Sequence similarities: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVV YARSKTAVYKVPPF
• Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Size: 100 μg

Gene Information

• Gene Name: PTRF polymerase I and transcript release factor [ Homo sapiens ]
• Official Symbol: PTRF
• Synonyms: PTRF; polymerase I and transcript release factor; cavin 1; CAVIN1; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor; CGL4; CAVIN; FKSG13; cavin-1; FLJ90031
• Gene ID: 284119
• mRNA Refseq: NM_012232
• Protein Refseq: NP_036364
• MIM: 603198
• UniProt ID: Q6NZI2
• Chromosome Location: 17q21.31
• Pathway: Gene Expression, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I Transcription Termination, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem
• Function: protein binding; rRNA primary transcript binding