Mouse Anti-PTRF Monoclonal Antibody
Cat.No. : | DMABT-H14716 |
Product Overview : | Mouse Anti-PTRF Monoclonal Antibody |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mouse |
Tag : | Non |
Target : | PTRF |
Immunogen : | PTRF (NP_036364, 233 a.a. ~432a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Isotype : | IgG2b Kappa |
species : | Human |
Clone : | 2G8 |
Conjugation : | N/A |
Applications : | WB,IHC,ICC,IP |
Sequence similarities : | KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVV YARSKTAVYKVPPF |
Storage : | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Size : | 100 μg |
Gene Name | PTRF polymerase I and transcript release factor [ Homo sapiens ] |
Official Symbol | PTRF |
Synonyms | PTRF; polymerase I and transcript release factor; cavin 1; CAVIN1; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor; CGL4; CAVIN; FKSG13; cavin-1; FLJ90031; |
Gene ID | 284119 |
mRNA Refseq | NM_012232 |
Protein Refseq | NP_036364 |
MIM | 603198 |
UniProt ID | Q6NZI2 |
Chromosome Location | 17q21.31 |
Pathway | Gene Expression, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I Transcription Termination, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; |
Function | protein binding; rRNA primary transcript binding; |
◆ Recombinant Proteins | ||
PTRF-3163H | Recombinant Human PTRF Protein, MYC/DDK-tagged | +Inquiry |
PTRF-13711M | Recombinant Mouse PTRF Protein | +Inquiry |
PTRF-1114C | Recombinant Chicken PTRF | +Inquiry |
PTRF-7294M | Recombinant Mouse PTRF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTRF-1442HCL | Recombinant Human PTRF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTRF Products
Required fields are marked with *
My Review for All PTRF Products
Required fields are marked with *
0
Inquiry Basket