Mouse Anti-PTRF Monoclonal Antibody
| Cat.No. : | DMABT-H14716 |
| Product Overview : | Mouse Anti-PTRF Monoclonal Antibody |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mouse |
| Tag : | Non |
| Target : | PTRF |
| Immunogen : | PTRF (NP_036364, 233 a.a. ~432a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype : | IgG2b Kappa |
| species : | Human |
| Clone : | 2G8 |
| Conjugation : | N/A |
| Applications : | WB,IHC,ICC,IP |
| Sequence similarities : | KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVV YARSKTAVYKVPPF |
| Storage : | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Size : | 100 μg |
| Gene Name | PTRF polymerase I and transcript release factor [ Homo sapiens ] |
| Official Symbol | PTRF |
| Synonyms | PTRF; polymerase I and transcript release factor; cavin 1; CAVIN1; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor; CGL4; CAVIN; FKSG13; cavin-1; FLJ90031; |
| Gene ID | 284119 |
| mRNA Refseq | NM_012232 |
| Protein Refseq | NP_036364 |
| MIM | 603198 |
| UniProt ID | Q6NZI2 |
| Chromosome Location | 17q21.31 |
| Pathway | Gene Expression, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I Transcription Termination, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; |
| Function | protein binding; rRNA primary transcript binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTRF Products
Required fields are marked with *
My Review for All PTRF Products
Required fields are marked with *



