Purified fluorescent protein mStrawberry
| Cat.No. : | mStrawberry-18 |
| Product Overview : | Purified fluorescent protein mStrawberry, with N-terminal HIS tag, expressed in E. coli, 250ug |
| Availability | October 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Molecular Mass : | 26.6 kDa |
| AA Sequence : | MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILTPNFTYGSK AYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVELYERAEGR HSTGGMDELYK |
| Purity : | >80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | >50 ug/mL as determined by microplate BCA method |
| Storage Buffer : | PBS, pH7.4, 10% glycerol. |
| Publications : |
Measurement of 3-photon excitation and emission spectra and verification of Kasha’s rule for selected fluorescent proteins excited at the 1700-nm window (2019)
|
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mStrawberry Products
Required fields are marked with *
My Review for All mStrawberry Products
Required fields are marked with *
