Recombinant 2019-nCoV NSP9 protein, 10xHis-tagged
Cat.No. : | NSP9-4440V |
Product Overview : | Recombinant 2019-nCoV NSP9 protein(P0DTD1/YP_009742616.1)(1-113aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sars-Cov-2 |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-113aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
NSP9-1041H | Recombinant SARS-CoV-2 NSP9 Protein (N4118-Q4230), His tagged | +Inquiry |
NSP9-5747S | Recombinant SARS-CoV-2 NSP9 Protein (Asn4141-Gln4253), N-His tagged | +Inquiry |
nsp9-3011V | Recombinant COVID-19 nsp9 Protein(1-113aa), hFc-Flag-tagged | +Inquiry |
NSP9-4440V | Recombinant 2019-nCoV NSP9 protein, 10xHis-tagged | +Inquiry |
NSP9-027V | Recombinant COVID-19 NSP9 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSP9 Products
Required fields are marked with *
My Review for All NSP9 Products
Required fields are marked with *