Recombinant AAV-2 VP3 Protein

Cat.No. : VP3-1781A
Product Overview : Recombinant protein from the full-length sequence of AAV-2 major coat protein VP3 , was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : AAV2
Source : E.coli
Protein Length : 1-533aa
Description : major coat protein VP3 [Adeno-associated virus - 2].
Form : 50mM Tris, 300mM NaCl, 10% glycerol, pH 8.0.
Molecular Mass : The protein has a calculated MW of 60.3kDa.
AA Sequence : GSHMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNRQAATADVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.13 mg/ml
Gene Name AAV2gp07 major coat protein VP3 [ Adeno-associated virus - 2 ]
Official Symbol AAV2gp07
Synonyms VP3
Gene ID 4192016
Protein Refseq YP_680428.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VP3 Products

Required fields are marked with *

My Review for All VP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon