Recombinant Active Human BMP2 Protein, His-tagged(C-ter)
Cat.No. : | BMP2-11H |
Product Overview : | Recombinant Active Human BMP2 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 9.5 ng/mL. The specific activity of recombinant BMP-2 is > 3.2 x 10^6 IU/mg. |
AA Sequence : | MQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BMP2 bone morphogenetic protein 2 [ Homo sapiens ] |
Official Symbol | BMP2 |
Synonyms | BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2; |
Gene ID | 650 |
mRNA Refseq | NM_001200 |
Protein Refseq | NP_001191 |
MIM | 112261 |
UniProt ID | P12643 |
◆ Recombinant Proteins | ||
BMP2-260H | Recombinant Human BMP2 Protein, GST-tagged | +Inquiry |
BMP2-563P | Recombinant Pig BMP2 protein, His-tagged | +Inquiry |
BMP2-2430M | Recombinant Mouse BMP2 Protein | +Inquiry |
BMP2-0778H | Recombinant Human BMP2 Protein (Gln283-Arg396), C-His tagged | +Inquiry |
BMP2-1052M | Recombinant Mouse BMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2 Products
Required fields are marked with *
My Review for All BMP2 Products
Required fields are marked with *
0
Inquiry Basket