Recombinant Active Human BMP2 Protein, His-tagged(C-ter)

Species :	Human
Source :	E.coli
Tag :	His
Description :	The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. [provided by RefSeq, Jul 2008]
Form :	Powder
Bio-activity :	Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 9.5 ng/mL. The specific activity of recombinant BMP-2 is > 3.2 x 10^6 IU/mg.
AA Sequence :	MQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Endotoxin :	Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity :	> 95% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	BMP2 bone morphogenetic protein 2 [ Homo sapiens ]
Official Symbol	BMP2
Synonyms	BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2;
Gene ID	650
mRNA Refseq	NM_001200
Protein Refseq	NP_001191
MIM	112261
UniProt ID	P12643