Recombinant Active Human TNFSF9 Protein, His-tagged(C-ter)
Cat.No. : | TNFSF9-322H |
Product Overview : | Recombinant Active Human TNFSF9 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 0.7 ng/mL. |
AA Sequence : | MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens ] |
Official Symbol | TNFSF9 |
Synonyms | TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L; |
Gene ID | 8744 |
mRNA Refseq | NM_003811 |
Protein Refseq | NP_003802 |
MIM | 606182 |
UniProt ID | P41273 |
◆ Recombinant Proteins | ||
TNFSF9-1157H | Recombinant Human TNFSF9 Protein (Arg71-Glu254), HlgG1 Fc-tagged, Biotinylated | +Inquiry |
TNFSF9-5902H | Recombinant Human TNFSF9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF9-718H | Recombinant Human TNFSF9 protein, Fc-tagged | +Inquiry |
Tnfsf9-7446RF | Recombinant Rat Tnfsf9 Protein, His-tagged, FITC conjugated | +Inquiry |
TNFSF9-717HAF488 | Recombinant Human TNFSF9 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *
0
Inquiry Basket