Recombinant Active Mouse INHBB Protein, His-tagged(C-ter)

Cat.No. : Inhbb-221M
Product Overview : Recombinant Active Mouse INHBB Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta B subunit forms a homodimer, activin B, and also joins with the beta A subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is < 1 ng/mL.
AA Sequence : MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Inhbb inhibin beta-B [ Mus musculus ]
Official Symbol Inhbb
Synonyms INHBB; inhibin beta-B; inhibin beta B chain; activin beta-B chain;
Gene ID 16324
mRNA Refseq NM_008381
Protein Refseq NP_032407

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBB Products

Required fields are marked with *

My Review for All INHBB Products

Required fields are marked with *

0
cart-icon
0
compare icon