Recombinant Aeuquorea Victoria EGFP, His-tagged
Cat.No. : | EGFP-111A |
Product Overview : | Recombinant Aeuquorea Victoria EGFP, fused with his tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aequorea victoria |
Source : | E.coli |
Tag : | His |
Description : | FUNCTION: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. BIOPHYSICOCHEMICAL PROPERTIES: Excitation max (nm): 488; Emission max (nm): 509; Extinction coefficient (Cm-1M-1): 61000. SUBUNIT: Monomer. TISSUE SPECIFICITY: Photocytes. PTM: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), and oxidation of Tyr-(N+1) to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen. BIOTECHNOLOGY: Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. SIMILARITY: Belongs to the GFP family. |
Form : | Lyophilised |
Molecular Mass : | ~30 kDa |
AA Sequence : | Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK |
Purity : | 92% by SDS-PAGE |
Storage : | After reconstitution, aliquot and keep at -20°C for long-term storage; for short term keep at 4°C. |
Reconstitution : | Reconstitute in 100 μl of sterile water. Centrifuge to remove any insoluble material. |
Gene Name | EGFP protein |
Official Symbol | EGFP |
Synonyms | EGFP; Enhanced Green Fluorescent Protein |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFP Products
Required fields are marked with *
My Review for All EGFP Products
Required fields are marked with *
0
Inquiry Basket