"PL5" Related Products

By Species
By Source
By Tag

Recombinant Ambrosia artemisiifolia Pectate lyase 5 protein, His-SUMO-tagged

 Download Datasheet    See All PL5 Products
Bring this labeled protein directly to your bench!
Cat.No.: PL5-12a
Product Overview: Recombinant Ambrosia artemisiifolia Pectate lyase 5(26-396aa) fused with His-SUMO tag was expressed in E. coli.
Description: Pectate lyase 5 plaed an important role in many functions.
Source: E. coli
Species: Ambrosia artemisiifolia
Tag: His-SUMO
Molecular Mass: 55.82kD
AA Sequence: AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANP KEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNP GGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDE NIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLG RHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC
   Download Datasheet

Online Inquiry

Note： There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.