Recombinant Aspergillus flavus UOX therapeutic protein(Rasburicase)
| Cat.No. : | UOX-P046A |
| Product Overview : | Recombinant urate-oxidase enzyme is produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Aspergillus flavus |
| Source : | S.Cerevisiae |
| Tag : | Non |
| Protein Length : | 301aa |
| Description : | Our expression product is the active ingredient of Elitek and Fasturtec. |
| Molecular Mass : | 34.1 Kda |
| AA Sequence : | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQN PVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDI KSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATARE VTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDP NGLIKCTVGRSSLKSKL |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | UOX; Rasburicase |
| ◆ Recombinant Proteins | ||
| UOX-84H | Recombinant Urate Oxidase (Pseudogene) | +Inquiry |
| UOX-481Z | Recombinant Zebrafish UOX | +Inquiry |
| UOX-13A | Active Recombinant Aspergillus flavus Urate Oxidase, Tag Free | +Inquiry |
| UOX-17859M | Recombinant Mouse UOX Protein | +Inquiry |
| Uox-3453R | Recombinant Rat Uox protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UOX Products
Required fields are marked with *
My Review for All UOX Products
Required fields are marked with *
