Recombinant Aspergillus flavus UOX therapeutic protein(Rasburicase)
Cat.No. : | UOX-P046A |
Product Overview : | Recombinant urate-oxidase enzyme is produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus flavus |
Source : | S.Cerevisiae |
Tag : | Non |
Protein Length : | 301aa |
Description : | Our expression product is the active ingredient of Elitek and Fasturtec. |
Molecular Mass : | 34.1 Kda |
AA Sequence : | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQN PVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDI KSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATARE VTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDP NGLIKCTVGRSSLKSKL |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | UOX; Rasburicase |
◆ Recombinant Proteins | ||
UOX-13A | Active Recombinant Aspergillus flavus Urate Oxidase, Tag Free | +Inquiry |
UOX-481Z | Recombinant Zebrafish UOX | +Inquiry |
UOX-1553A | Recombinant Arthrobacter Globiformis UOX Protein (11-297 aa), His-tagged | +Inquiry |
Uox-3453R | Recombinant Rat Uox protein | +Inquiry |
UOX-80H | Active Recombinant Urate Oxidase | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UOX Products
Required fields are marked with *
My Review for All UOX Products
Required fields are marked with *