Recombinant Aspergillus Niger AGLB Protein (21-443 aa), His-tagged
Cat.No. : | AGLB-1629A |
Product Overview : | Recombinant Aspergillus Niger (strain CBS 513.88/FGSC A1513) AGLB Protein (21-443 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus Niger |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-443 aa |
Description : | Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.7 kDa |
AA Sequence : | DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | aglB; Melibiase B; |
UniProt ID | A2QEJ9 |
◆ Recombinant Proteins | ||
AGLB-1629A | Recombinant Aspergillus Niger AGLB Protein (21-443 aa), His-tagged | +Inquiry |
AGLB-971A | Recombinant Aspergillus Niger AGLB Protein (21-443 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGLB Products
Required fields are marked with *
My Review for All AGLB Products
Required fields are marked with *
0
Inquiry Basket