Recombinant B. subtilis pbpC Protein, His-tagged
| Cat.No. : | pbpC-1321B |
| Product Overview : | Recombinant B. subtilis pbpC Protein (21-240aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | B.subtilis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-240 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 29.2 kDa |
| AA Sequence : | CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDD QDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRG QIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKP DQEKLVSEAT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | pbpC penicillin-binding protein 3 [ Bacillus subtilis subsp. subtilis str. 168 ] |
| Official Symbol | pbpC |
| Synonyms | penicillin-binding protein 3 |
| Gene ID | 940139 |
| Protein Refseq | NP_388295.1 |
| UniProt ID | P42971 |
| ◆ Recombinant Proteins | ||
| PBPC-1063B | Recombinant Bacillus subtilis PBPC protein, His-tagged | +Inquiry |
| pbpC-1321B | Recombinant B. subtilis pbpC Protein, His-tagged | +Inquiry |
| pbpC-4549B | Recombinant Bacillus subtilis (strain 168) pbpC protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All pbpC Products
Required fields are marked with *
My Review for All pbpC Products
Required fields are marked with *



