"cre" Related Products

Recombinant Bacteriophage P1 cre protein, T7/His-tagged

Cat.No.: cre-145B
Product Overview: Recombinant Bacteriophage P1 cre protein fused with 11 arginine domain at C-terminal and T7 tag/His/TEV cleavage site tag at N-terminal, was expressed in E. coli.
Source: E. coli
Species: Bacteriophage P1
Tag: Arginine
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with 100 mM NaCl, 10 mM KCl, 1 mM DTT and 10% Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFPPKKKRKVSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSE HTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVS LVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTD GGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGI FEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLL EDGDLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein intracellular transduction for in vitro Cre-loxP recombination.2. Negative control for 11R-Tag human transcription factor mediated cell differentiation assay in vitro.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: cre cyclization recombinase [ Enterobacteria phage P1 ]
Official Symbol: cre
Synonyms: cyclization recombinase; Cre
Gene ID: 2777477
mRNA Refseq:
Protein Refseq:
MIM:
UniProt ID: P06956

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.