Recombinant Baker's yeast(strain ATCC 204508 / S288c) PEP4 protein, His-sumostar-tagged
| Cat.No. : | PEP4-1432B |
| Product Overview : | Recombinant Baker''s yeast(strain ATCC 204508 / S288c) PEP4 protein(P07267)(77-405aa), fused with N-terminal His and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Yeast |
| Source : | Yeast |
| Tag : | His&SUMO |
| Protein Length : | 77-405aa |
| Tag : | N-His-sumostar |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI |
| ◆ Recombinant Proteins | ||
| PEP4-1432B | Recombinant Baker's yeast(strain ATCC 204508 / S288c) PEP4 protein, His-sumostar-tagged | +Inquiry |
| PEP4-4208B | Recombinant Baker's yeast PEP4 protein, His-tagged | +Inquiry |
| PEP4-5707Y | Recombinant Yeast PEP4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEP4 Products
Required fields are marked with *
My Review for All PEP4 Products
Required fields are marked with *
