Recombinant Borrelia ospA therapeutic protein(Lyme disease vaccine (recombinant OspA))
| Cat.No. : | ospA-P045H | 
| Product Overview : | Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Borrelia | 
| Source : | E.coli | 
| Tag : | Non | 
| Protein Length : | 257aa | 
| Description : | Our expression product is the active ingredient of LYMErix. | 
| Molecular Mass : | 27.7 Kda | 
| AA Sequence : | MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDVPGGMKVLVSKEKNKDGKYDLMATVDNVDLKGTSDKNN GSGILEGVKADKSKVKLTVADDLSKTTLEVLKEDGTVVSRKVTSKDKSTTEAKFNEKGELSEKTMTRANGT TLEYSQMTNEDNAAKAVETLKNGIKFEGNLASGKTAVEIKEGTVTLKREIDKNGKVTVSLNDTASGSKKTA SWQESTSTLTISANSKKTKDLVFLTNGTITVQNYDSAGTKLEGSAAEIKKLDELKNALR | 
| Purity : | >95% | 
| ◆ Recombinant Proteins | ||
| ospA-4451B | Recombinant Borrelia burgdorferi ospA protein, His-tagged | +Inquiry | 
| OspA-07B | Recombinant B. burgdorferi OspA Protein, MBP-tagged | +Inquiry | 
| ospA-14B | Recombinant Borrelia Burgdorferi ospA protein, His-tagged | +Inquiry | 
| ospA-4222B | Recombinant Borrelia burgdorferi ospA protein, His&Myc-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ospA Products
Required fields are marked with *
My Review for All ospA Products
Required fields are marked with *
  
        
    
      
            