Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged

Cat.No. : ASIP-1930B
Product Overview : Recombinant Bovine ASIP Protein (23-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : His&SUMO
Protein Length : 23-133 aa
Description : Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.4 kDa
AA Sequence : HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name ASIP agouti signaling protein [ Bos taurus (cattle) ]
Official Symbol ASIP
Synonyms ASIP; Agouti switch protein;
Gene ID 404192
mRNA Refseq NM_206843
Protein Refseq NP_996674
UniProt ID Q29414

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASIP Products

Required fields are marked with *

My Review for All ASIP Products

Required fields are marked with *

0
cart-icon
0
compare icon