Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged

• Cat.No.: ASIP-1930B
• Product Overview: Recombinant Bovine ASIP Protein (23-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 23-133 aa
• Description: Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.4 kDa
• AA Sequence: HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ASIP agouti signaling protein [ Bos taurus (cattle) ]
• Official Symbol: ASIP
• Synonyms: ASIP; Agouti switch protein
• Gene ID: 404192
• mRNA Refseq: NM_206843
• Protein Refseq: NP_996674
• UniProt ID: Q29414