Recombinant Bovine ATP6V1G1 protein
| Cat.No. : | ATP6V1G1-5233B |
| Product Overview : | Recombinant Bovine ATP6V1G1 protein(P79251)(2-118 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 2-118 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAA ALGSHGSCSTEVEKDTQEKMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHENYRING |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| ATP6V1G1-1009H | Recombinant Human ATP6V1G1 protein, GST-tagged | +Inquiry |
| ATP6V1G1-5235B | Recombinant Bovine ATP6V1G1 protein | +Inquiry |
| ATP6V1G1-5234B | Recombinant Bovine ATP6V1G1 protein, Avi-tagged, Biotinylated | +Inquiry |
| Atp6v1g1-1775M | Recombinant Mouse Atp6v1g1 Protein, Myc/DDK-tagged | +Inquiry |
| ATP6V1G1-5232B | Recombinant Bovine ATP6V1G1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP6V1G1-8577HCL | Recombinant Human ATP6V1G1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V1G1 Products
Required fields are marked with *
My Review for All ATP6V1G1 Products
Required fields are marked with *
