"CXCL9" Related Products

Expand
Expand
Expand

Recombinant Bovine CXCL9 protein

Cat.No. : CXCL9-849B
Product Overview : Recombinant Bovine CXCL9 protein was expressed in E.coli.
Description : CXCL9 is a T-cell chemoattractant induced by IFN-γ belonging to the CXC chemokine family and it is also known as Monokine induced by gamma interferon (MIG). CXCL9 is closely related to two other CXC chemokines called CXCL10 and CXCL11 and they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response and chemotactic for activated T-cells. Recombinant bovine CXCL9 contains 104 amino acids which is a single non-glycosylated polypeptide chain. The bovine CXCL9 shares 92 % and 72 % a.a. sequence identity with sheep and human CXCL9.
Source : E.coli
Species : Bovine
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.0, 500 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml.
Molecular Mass : Approximately 11.9 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. But it migrates with an apparent molecular mass of 18 kDa in SDS-PAGE.
Protein length : 104
AA Sequence : VPAIRNGRCSCINTSQGMIHPKSLKDLKQFAPSPSCEKTEIIATMKNGNEACLNPDLPEVKELIKEWEKQVNQKKKQRKGKKYKKTKKVPKVKRSQRPSQKKTT
Endotoxin : Less than 0.1 EU/μg of rBoMIG/CXCL9 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CXCL9
Official Symbol : CXCL9
Synonyms : CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10;
Gene ID : 513990
mRNA Refseq : NM_001113172.1
Protein Refseq : NP_001106643.1
UniProt ID : A9QWP9

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.