Recombinant Bovine FBN1 protein(2732-2871aa), His-tagged
Cat.No. : | FBN1-753B |
Product Overview : | Recombinant Bovine FBN1 protein(P98133)(2732-2871aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 2732-2871aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SANETDASNIEDQPEIEANVSLASWDVEKTAVFAFNISHISNKVRILELLPALTTLTNHNRYLIESGNENGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQILLH |
◆ Recombinant Proteins | ||
Fbn1-1465M | Recombinant Mouse Fbn1 Protein, His-tagged | +Inquiry |
Fbn1-2625M | Recombinant Mouse Fbn1 protein, His-tagged | +Inquiry |
Fbn1-2626M | Recombinant Mouse Fbn1 protein, His-tagged | +Inquiry |
FBN1-3878H | Recombinant Human FBN1 Protein, GST-tagged | +Inquiry |
FBN1-753B | Recombinant Bovine FBN1 protein(2732-2871aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBN1 Products
Required fields are marked with *
My Review for All FBN1 Products
Required fields are marked with *
0
Inquiry Basket