Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged
| Cat.No. : | FDX1-2624B |
| Product Overview : | Recombinant Bovine FDX1 Protein (59-186 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 59-186 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 19.5 kDa |
| AA Sequence : | SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | FDX1 ferredoxin 1 [ Bos taurus (cattle) ] |
| Official Symbol | FDX1 |
| Synonyms | FDX1; |
| Gene ID | 281157 |
| mRNA Refseq | NM_181011 |
| Protein Refseq | NP_851354 |
| UniProt ID | P00257 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDX1 Products
Required fields are marked with *
My Review for All FDX1 Products
Required fields are marked with *




