Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged

• Cat.No.: FDX1-2624B
• Product Overview: Recombinant Bovine FDX1 Protein (59-186 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Protein Length: 59-186 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.5 kDa
• AA Sequence: SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: FDX1 ferredoxin 1 [ Bos taurus (cattle) ]
• Official Symbol: FDX1
• Synonyms: FDX1
• Gene ID: 281157
• mRNA Refseq: NM_181011
• Protein Refseq: NP_851354
• UniProt ID: P00257