Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged
Cat.No. : | FDX1-2624B |
Product Overview : | Recombinant Bovine FDX1 Protein (59-186 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 59-186 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.5 kDa |
AA Sequence : | SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | FDX1 ferredoxin 1 [ Bos taurus (cattle) ] |
Official Symbol | FDX1 |
Synonyms | FDX1; |
Gene ID | 281157 |
mRNA Refseq | NM_181011 |
Protein Refseq | NP_851354 |
UniProt ID | P00257 |
◆ Recombinant Proteins | ||
Fdx1-1476M | Recombinant Mouse Fdx1 Protein, His&GST-tagged | +Inquiry |
Fdx1-3225R | Recombinant Rat Fdx1, His-tagged | +Inquiry |
Fdx1-2981M | Recombinant Mouse Fdx1 Protein, Myc/DDK-tagged | +Inquiry |
FDX1-4060H | Recombinant Human FDX1 Protein | +Inquiry |
FDX1-2624B | Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDX1 Products
Required fields are marked with *
My Review for All FDX1 Products
Required fields are marked with *