Recombinant Bovine INSL3 protein, His-KSI-tagged
| Cat.No. : | INSL3-7764B |
| Product Overview : | Recombinant Bovine INSL3 protein(O77801)(22-66aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 22-66a.a. |
| Tag : | His-KSI |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GPAAAQEAPEKLCGHHFVRALVRLCGGPRWSSEEDGRPVAGGDRE |
| ◆ Recombinant Proteins | ||
| INSL3-3377H | Recombinant Human INSL3 Protein (Asp2-Cys129), N-His tagged | +Inquiry |
| INSL3-1047H | Recombinant Human INSL3 protein, His & T7-tagged | +Inquiry |
| INSL3-2736R | Recombinant Rat INSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Insl3-1062R | Recombinant Rat Insl3 Protein, His&SUMO-tagged | +Inquiry |
| Insl3-1048R | Recombinant Rat Insl3 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSL3-5191HCL | Recombinant Human INSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSL3 Products
Required fields are marked with *
My Review for All INSL3 Products
Required fields are marked with *
