Recombinant Bovine LAP3 protein, His-SUMO-tagged
Cat.No. : | LAP3-4453B |
Product Overview : | Recombinant Bovine LAP3 protein(P00727)(25-64aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-64aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.3 kDa |
AA Sequence : | PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
LAP3-108HFL | Active Recombinant Full Length Human LAP3 Protein, C-Flag-tagged | +Inquiry |
Lap3-2760R | Recombinant Rat Lap3 protein, His-tagged | +Inquiry |
LAP3-27947TH | Recombinant Human LAP3, His-tagged | +Inquiry |
LAP3-2283R | Recombinant Rhesus Macaque LAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAP3-6483Z | Recombinant Zebrafish LAP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAP3-4824HCL | Recombinant Human LAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAP3 Products
Required fields are marked with *
My Review for All LAP3 Products
Required fields are marked with *
0
Inquiry Basket