Recombinant Bovine LAP3 protein, His-SUMO-tagged
Cat.No. : | LAP3-4453B |
Product Overview : | Recombinant Bovine LAP3 protein(P00727)(25-64aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Bovine |
Tag : | His-SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.3 kDa |
Protein length : | 25-64aa |
AA Sequence : | PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Products Types
◆ Recombinant Protein | ||
LAP3-3010R | Recombinant Rat LAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAP3-2283R | Recombinant Rhesus Macaque LAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAP3-4992M | Recombinant Mouse LAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lap3-3753M | Recombinant Mouse Lap3 Protein, Myc/DDK-tagged | +Inquiry |
LAP3-1278H | Recombinant Human LAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
LAP3-4824HCL | Recombinant Human LAP3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket