Recombinant Bovine MB protein
| Cat.No. : | MB-5333B |
| Product Overview : | Recombinant Bovine MB protein(P02192)(2-154aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | 2-154aa |
| Tag : | Non |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG |
| ◆ Recombinant Proteins | ||
| MB-5391M | Recombinant Mouse MB Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mb-2679M | Recombinant Mouse Mb protein, His-tagged | +Inquiry |
| MB-2680S | Recombinant Sheep MB protein, His & T7-tagged | +Inquiry |
| MB-2165W | Recombinant Sperm Whale Myoglobin | +Inquiry |
| MB-72S | Recombinant Sperm Whale MB Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MB-236B | Native Bovine Myoglobin | +Inquiry |
| Mb-8229M | Native Mouse Myoglobin | +Inquiry |
| Mb-8232R | Native Rat Myoglobin | +Inquiry |
| MB-30275TH | Native Human MB | +Inquiry |
| MB-4460H | Native Human Myoglobin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
| MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
