Recombinant Bovine RHO protein, His-KSI-tagged
Cat.No. : | RHO-4517B |
Product Overview : | Recombinant Bovine RHO protein(P02699)(1-36aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Bovine |
Tag : | His-KSI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.5 kDa |
Protein length : | 1-36aa |
AA Sequence : | MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Products Types
◆ Recombinant Protein | ||
RHO-600C | Recombinant Cynomolgus Monkey RHO Protein, His (Fc)-Avi-tagged | +Inquiry |
RHO-3988H | Recombinant Human RHO Protein, His (Fc)-Avi-tagged | +Inquiry |
RHO-4693R | Recombinant Rat RHO Protein, His (Fc)-Avi-tagged | +Inquiry |
RHO-5034R | Recombinant Rat RHO Protein | +Inquiry |
RHO-355H | Recombinant Human RHO | +Inquiry |
◆ Assay kits | ||
Kit-0767 | Rho-kinase (Human) Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket