Recombinant Bovine SFTPB Protein (23-187 aa), His-Myc-tagged

Cat.No. : SFTPB-2286B
Product Overview : Recombinant Bovine SFTPB Protein (23-187 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : His&Myc
Protein Length : 23-187 aa
Description : Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 23.5 kDa
AA Sequence : AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name SFTPB surfactant protein B [ Bos taurus (cattle) ]
Official Symbol SFTPB
Synonyms SFTPB;
Gene ID 507398
mRNA Refseq NM_001075311
Protein Refseq NP_001068779
UniProt ID P15781

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFTPB Products

Required fields are marked with *

My Review for All SFTPB Products

Required fields are marked with *

0
cart-icon