Recombinant Bovine SFTPB Protein (23-187 aa), His-Myc-tagged
Cat.No. : | SFTPB-2286B |
Product Overview : | Recombinant Bovine SFTPB Protein (23-187 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-187 aa |
Description : | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.5 kDa |
AA Sequence : | AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SFTPB surfactant protein B [ Bos taurus (cattle) ] |
Official Symbol | SFTPB |
Synonyms | SFTPB; |
Gene ID | 507398 |
mRNA Refseq | NM_001075311 |
Protein Refseq | NP_001068779 |
UniProt ID | P15781 |
◆ Recombinant Proteins | ||
SFTPB-2223H | Recombinant Human SFTPB Protein (201-279 aa) | +Inquiry |
SFTPB-5358R | Recombinant Rat SFTPB Protein | +Inquiry |
SFTPB-5970P | Recombinant Pig SFTPB protein | +Inquiry |
SFTPB-2810H | Recombinant Human SFTPB Protein (201-279 aa), MBP-tagged | +Inquiry |
Sftpb-5816M | Recombinant Mouse Sftpb Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *