Recombinant Candida albicans (strain WO-1) SAP2 protein, His-Myc-tagged
| Cat.No. : | SAP2-4541C |
| Product Overview : | Recombinant Candida albicans (strain WO-1) SAP2 protein(C4YMJ3)(57-398aa), fused to C-terminal His tag and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Candida albicans |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 57-398aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.1 kDa |
| AA Sequence : | QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDNNEISLAQVKYTSASSISALT |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| SAP2-6743Y | Recombinant Yeast SAP2 protein, His-tagged | +Inquiry |
| SAP2-636Y | Recombinant Yeast SAP2 protein, His-tagged | +Inquiry |
| SAP2-5881Y | Recombinant Yeast SAP2 protein, His-tagged | +Inquiry |
| SAP2-4542C | Recombinant Candida albicans (strain WO-1) SAP2 protein, His-tagged | +Inquiry |
| SAP2-4541C | Recombinant Candida albicans (strain WO-1) SAP2 protein, His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAP2 Products
Required fields are marked with *
My Review for All SAP2 Products
Required fields are marked with *
