Recombinant Canine IL8 protein
Cat.No. : | IL8-571D |
Product Overview : | Recombinant Canine IL8 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine |
Source : | E.coli |
Tag : | Non |
Protein Length : | 79 |
Description : | Interleukin-8 (IL-8) is encoded by the IL8 gene andproduced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. . IL-8 is often associated with inflammation and has been cited as a proinflammatory mediator in gingivitis and psoriasis. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.15-0.75 ng/ml. |
Molecular Mass : | Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 79 amino acids. |
AA Sequence : | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
Endotoxin : | Less than 1 EU/μg of rCaIL-8/CXCL8 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL8 |
Official Symbol | IL8 |
Synonyms | (Ser-IL-8)72, GCP/IL-8 protein I, IL8/NAP1 form III, LYNAP, MDNCF-c, NAF |
Gene ID | 403850 |
mRNA Refseq | NM_001003200.1 |
Protein Refseq | NP_001003200.1 |
UniProt ID | P41324 |
◆ Recombinant Proteins | ||
IL8-4444H | Recombinant Human IL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL8-360H | Active Recombinant Human IL8 (28-99aa) | +Inquiry |
IL8-190P | Recombinant Porcine IL8 Protein | +Inquiry |
IL8-245C | Recombinant Canine Interleukin 8 | +Inquiry |
IL8-0205C | Active Recombinant Cynomolgus IL8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
IL8-3002HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
0
Inquiry Basket