Recombinant Cat SAA1 Protein (1-90 aa), His-tagged

• Cat.No.: SAA1-1512C
• Product Overview: Recombinant Cat SAA1 Protein (1-90 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Cat
• Source: Yeast
• Tag: His
• Protein Length: 1-90 aa
• Description: Major acute phase reactant. Apolipoprotein of the HDL complex.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.1 kDa
• AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: SAA1 serum amyloid A1 [ Felis catus ]
• Official Symbol: SAA1
• Synonyms: SAA1; serum amyloid A1; serum amyloid A; SAA
• Gene ID: 678660
• mRNA Refseq: NM_001040198
• Protein Refseq: NP_001035288
• UniProt ID: P19707