Recombinant Chicken CXCL8 protein, His-tagged
Cat.No. : | CXCL8-3108C |
Product Overview : | Recombinant Chicken CXCL8 protein(P08317)(17-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | 17-102aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.4 kDa |
AA Sequence : | ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
CXCL8-002H | Recombinant Human CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-1111R | Recombinant Rhesus monkey CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-17H | Recombinant Human CXCL8 Protein, Biotin-tagged | +Inquiry |
CXCL8-3109C | Recombinant Chicken CXCL8 protein | +Inquiry |
CXCL8-344H | Recombinant Human CXCL8 protein(Ser28-Ser99), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *