Recombinant Chicken FGF2 protein, His-tagged

Cat.No. : FGF2-6739C
Product Overview : Recombinant Chicken FGF2 protein(NP_990764.1)(Phe29~Gly143), fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : E.coli
Tag : His
Protein Length : Phe29~Gly143
Form : 100mMNaHCO3, 500mMNaCl, pH8.3, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 17/20kDa(Analysis of differences refer to the manual)
AA Sequence : FKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTG
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 95%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein.
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Reconstitution : Reconstitute in 100mM NaHCO3, 500mM NaCl (pH8.3) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name FGF2 fibroblast growth factor 2 [ Gallus gallus (chicken) ]
Official Symbol FGF2
Synonyms B-FGF; BFGF; FGFB; HBGH-2; Basic Fibroblast Growth Factor; Heparin-binding growth factor 2
Gene ID 396413
mRNA Refseq NM_205433.1
Protein Refseq NP_990764.1
UniProt ID P48800

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF2 Products

Required fields are marked with *

My Review for All FGF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon