Recombinant Chicken FGF2 protein, His-tagged
| Cat.No. : | FGF2-6739C |
| Product Overview : | Recombinant Chicken FGF2 protein(NP_990764.1)(Phe29~Gly143), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Phe29~Gly143 |
| Form : | 100mMNaHCO3, 500mMNaCl, pH8.3, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
| Molecular Mass : | 17/20kDa(Analysis of differences refer to the manual) |
| AA Sequence : | FKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTG |
| Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
| Purity : | > 95% |
| Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
| Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
| Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
| Reconstitution : | Reconstitute in 100mM NaHCO3, 500mM NaCl (pH8.3) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
| Gene Name | FGF2 fibroblast growth factor 2 [ Gallus gallus (chicken) ] |
| Official Symbol | FGF2 |
| Synonyms | B-FGF; BFGF; FGFB; HBGH-2; Basic Fibroblast Growth Factor; Heparin-binding growth factor 2 |
| Gene ID | 396413 |
| mRNA Refseq | NM_205433.1 |
| Protein Refseq | NP_990764.1 |
| UniProt ID | P48800 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *



